WebRankStats
Mcfarlaneasphaltdrivewaypaving.com Website Stats
|
(Updated 3935 days ago)
|
|
General Information
 Meta Description : |
For the best Asphalt driveway Paving in NJ, call McFarlane Paving . We also offer paving, repairs services. Call us today for your free estimate. |
|---|---|
| Meta Keywords : |
|
| XML Sitemap : |
|
| Robots.txt : |
|
| Gzip Compress : |
|
| Text/HTML Ratio : |
7.04% |
Website Ranks
| Alexa Rank : |
2,711,450 visit Alexa |
|---|---|
| Compete Rank : |
N/A visit Compete |
| Quantcast Rank : |
N/A visit Quantcast |
Website Safety
| McAfee SiteAdvisor : |
 visit SiteAdvisor
|
|---|---|
| WOT : |
 visit WOT
|
Pages Indexed
| Google : |
0 visit Google
|
|---|---|
| Bing : |
1 visit Bing
|
Backlinks
| Google : |
0 visit Google
|
|---|---|
| Bing : |
0 visit Bing
|
Sociometer
| Facebook Likes : |
0 |
|---|---|
| Stumbleupon : |
1 |
| LinkedIn : |
Server Analysis
| IP Address : | 216.40.47.17 |
|---|---|
| Latitude : | 43.6391 |
| Longitude : | -79.4259 |
| Region : | TORONTO, ONTARIO |
| Country : | CANADA |
HTTP Header Analysis
HTTP Header reponses of mcfarlaneasphaltdrivewaypaving.com is the information we get when HTTP request sent to a server from connecting clients(e.g. chrome, firefox). When you input an address into your browser it sends a request to the server hosting the domain and the server responds. HTTP Header information is not directly displayed by normal web browsers like chrome, firefox etc.
HTTP/1.1 302 Moved Temporarily Server: Apache-Coyote/1.1 Location: http://www.mcfarlaneasphaltdrivewaypaving.com Content-Length: 0 Date: Fri, 24 Jan 2014 18:17:53 GMT Connection: close HTTP/1.1 200 OK Content-Type: text/html Server: Microsoft-IIS/7.5 Date: Fri, 24 Jan 2014 18:17:53 GMT Content-Length: 30953 Vary: Accept-Encoding |
DNS Record Analysis
There are total 6 records in domain name system (DNS) of mcfarlaneasphaltdrivewaypaving.com, which includes 1 Address(A) record, 1 Mail Exchange(MX) record, 3 Name Server(NS) records and 1 Start of Authority(SOA) record.
|
